PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC023257.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 49aa    MW: 5380.33 Da    PI: 10.3689
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC023257.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like537.8e-174332655
       G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                  +AtPk +l+lm+v gL+++hvkSHLQ+YR+
  EcC023257.10  4 EATPKLVLQLMNVRGLSIAHVKSHLQMYRS 33
                  6****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015576.1E-12335IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.2E-15334IPR009057Homeodomain-like
SuperFamilySSF466894.12E-6434IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0006855Biological Processdrug transmembrane transport
GO:0016020Cellular Componentmembrane
GO:0003677Molecular FunctionDNA binding
GO:0015238Molecular Functiondrug transmembrane transporter activity
GO:0015297Molecular Functionantiporter activity
Sequence ? help Back to Top
Protein Sequence    Length: 49 aa     Download sequence    Send to blast
MGTEATPKLV LQLMNVRGLS IAHVKSHLQM YRSKKLDDSG QGKLGTLLD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442650.16e-18hypothetical protein SORBIDRAFT_08g000510
RefseqXP_007216041.16e-18hypothetical protein PRUPE_ppa017500mg, partial
RefseqXP_010915503.11e-17PREDICTED: two-component response regulator ARR18-like isoform X1
RefseqXP_010915504.11e-17PREDICTED: two-component response regulator ARR18-like isoform X2
TrEMBLM1AN511e-18M1AN51_SOLTU; Uncharacterized protein
STRINGVIT_12s0028g02080.t012e-17(Vitis vinifera)
STRINGSb08g000510.12e-17(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.15e-18G2-like family protein